[30553] in Perl-Users-Digest
Perl-Users Digest, Issue: 1796 Volume: 11
daemon@ATHENA.MIT.EDU (Perl-Users Digest)
Fri Aug 15 21:09:52 2008
Date: Fri, 15 Aug 2008 18:09:16 -0700 (PDT)
From: Perl-Users Digest <Perl-Users-Request@ruby.OCE.ORST.EDU>
To: Perl-Users@ruby.OCE.ORST.EDU (Perl-Users Digest)
Perl-Users Digest Fri, 15 Aug 2008 Volume: 11 Number: 1796
Today's topics:
Re: Backreferences: alias vs copy <mjcarman@mchsi.com>
Help: Show specific part <openlinuxsource@gmail.com>
Re: Help: Show specific part <jurgenex@hotmail.com>
Re: Help: Show specific part <openlinuxsource@gmail.com>
Re: Help: Show specific part <jurgenex@hotmail.com>
Re: Help: Show specific part <openlinuxsource@gmail.com>
Re: Help: Show specific part <jurgenex@hotmail.com>
Re: How do I produce a useful error message when a file <spamtrap@dot-app.org>
Re: How do I produce a useful error message when a file <tadmc@seesig.invalid>
How do I produce a useful error message when a file upl <sstark@hi-beam.net>
Re: How do I produce a useful error message when a file <sstark@hi-beam.net>
Perl Dev Kit <slick.users@gmail.com>
Re: Perl Dev Kit <ben@morrow.me.uk>
Re: Perl Dev Kit <jurgenex@hotmail.com>
Re: Perl Dev Kit <john@castleamber.com>
Re: perlish way for ( 0 .. $n) , but downcounting xhoster@gmail.com
Re: This is very OT, and its just a request. It has to <tadmc@seesig.invalid>
Digest Administrivia (Last modified: 6 Apr 01) (Perl-Users-Digest Admin)
----------------------------------------------------------------------
Date: Fri, 15 Aug 2008 22:58:54 GMT
From: Michael Carman <mjcarman@mchsi.com>
Subject: Re: Backreferences: alias vs copy
Message-Id: <OSnpk.244832$TT4.28071@attbi_s22>
John W. Krahn wrote:
> They are not *exactly* the same. You can assign to
> substr($var, $-[1], $+[1] - $-[1]) but you cannot assign to $1.
Well, yes, there is that. :)
Willem wrote:
> a lot of the language is just that: syntactic sugar. That should alo
> make it reasonably easy to implement, I would venture. (Unless $1
> were sometimes a copy and not always an alias...)
Judging by the experiments in the other branch of this thread, that
appears to be the case.
-mjc
------------------------------
Date: Fri, 15 Aug 2008 20:54:15 +0800
From: Amy Lee <openlinuxsource@gmail.com>
Subject: Help: Show specific part
Message-Id: <pan.2008.08.15.12.54.13.787523@gmail.com>
Hello,
I'm a newbie in Perl and do some work in Bioinformatics. I write a tiny
script to show the sequences. However, I have a problem while I'm going to
further process.
My output looks like this.
>xxx
IGRRQWASLVTPMAKFDPEIVLEFYANAWPTEEGVRDMRSWVRGQWIPFDADA
IGQLLGYPLVLEEGQECEYGQRRNRSDGFDEEA
>yyy
gaggccatcaagggatggtcgtttctccgggagcaacgcgtccagctcagggacgacgag
tatactgatttccaggaggaaatagggcgccggcagtgggcatcactggttactcccatg
gccaagttcgatccggaaatagtccttgagttttatgccaatgcttggccaacagaggag
>zzz
EGDAHAVSSTPAWVKPQQTPHGTHQYAQHHPSFSAHAGNASSST
PVQPKAPTQREAPQVPTPNTTRPAGNSNTTRNFPPRPLPEFTPLPMTYEDLLPSLIANHL
AVVTPGRVLEPPFPKWYDPNATCKYHGGVPGHSVEKCLALKYKVQHLMDAGWLTFQEDRP
NVRTNPLANHGGGAVNAVESD
>qqq
tggaagccgcagaagaatcgttagaaactgctttccag
tcttttgaggtggtcagcatttcctccgtggactccctctttgggcaaccttgtctgtcc
gatgcagcggtaatgatggcccgagttatgttggggaacggttttgaacccgggatgggt
ttagaaaaaaacaacggcggcataactagc
And I hope I can save the whole protein sequences with their
tags(>blahblah) into a file, like "protein" and save DNA sequences into
"dna" file.
So from that, "protein" is
>xxx
IGRRQWASLVTPMAKFDPEIVLEFYANAWPTEEGVRDMRSWVRGQWIPFDADA
IGQLLGYPLVLEEGQECEYGQRRNRSDGFDEEA
>zzz
EGDAHAVSSTPAWVKPQQTPHGTHQYAQHHPSFSAHAGNASSST
PVQPKAPTQREAPQVPTPNTTRPAGNSNTTRNFPPRPLPEFTPLPMTYEDLLPSLIANHL
AVVTPGRVLEPPFPKWYDPNATCKYHGGVPGHSVEKCLALKYKVQHLMDAGWLTFQEDRP
NVRTNPLANHGGGAVNAVESD
"dna" is
>yyy
gaggccatcaagggatggtcgtttctccgggagcaacgcgtccagctcagggacgacgag
tatactgatttccaggaggaaatagggcgccggcagtgggcatcactggttactcccatg
gccaagttcgatccggaaatagtccttgagttttatgccaatgcttggccaacagaggag
>qqq
tggaagccgcagaagaatcgttagaaactgctttccag
tcttttgaggtggtcagcatttcctccgtggactccctctttgggcaaccttgtctgtcc
gatgcagcggtaatgatggcccgagttatgttggggaacggttttgaacccgggatgggt
ttagaaaaaaacaacggcggcataactagc
Because of lacking of Perl knowledge, could you show me some tips?
Thank you very much~
Regards,
Amy Lee
------------------------------
Date: Fri, 15 Aug 2008 13:02:12 GMT
From: Jürgen Exner <jurgenex@hotmail.com>
Subject: Re: Help: Show specific part
Message-Id: <sfvaa4tvas4bis9ebd0c1i3r5jlrdn0mqr@4ax.com>
Amy Lee <openlinuxsource@gmail.com> wrote:
>I'm a newbie in Perl and do some work in Bioinformatics. I write a tiny
>script to show the sequences. However, I have a problem while I'm going to
>further process.
>
>My output looks like this.
[snip lengthy text]
>And I hope I can save the whole protein sequences with their
>tags(>blahblah) into a file, like "protein" and save DNA sequences into
>"dna" file.
>
>So from that, "protein" is
[snip lenghty text]
>Because of lacking of Perl knowledge, could you show me some tips?
In how far is the text marked as "output" different from the part marked
as "protein"? They appear to be identical to me. But then again I did
not compare each and every character in those lengthy sequences.
jue
------------------------------
Date: Fri, 15 Aug 2008 21:15:21 +0800
From: Amy Lee <openlinuxsource@gmail.com>
Subject: Re: Help: Show specific part
Message-Id: <pan.2008.08.15.13.15.20.24933@gmail.com>
On Fri, 15 Aug 2008 13:02:12 +0000, Jürgen Exner wrote:
> Amy Lee <openlinuxsource@gmail.com> wrote:
>>I'm a newbie in Perl and do some work in Bioinformatics. I write a tiny
>>script to show the sequences. However, I have a problem while I'm going to
>>further process.
>>
>>My output looks like this.
> [snip lengthy text]
>
>>And I hope I can save the whole protein sequences with their
>>tags(>blahblah) into a file, like "protein" and save DNA sequences into
>>"dna" file.
>>
>>So from that, "protein" is
> [snip lenghty text]
>
>>Because of lacking of Perl knowledge, could you show me some tips?
>
> In how far is the text marked as "output" different from the part marked
> as "protein"? They appear to be identical to me. But then again I did
> not compare each and every character in those lengthy sequences.
>
> jue
Well, actually speaking, the protein is upper letter, and dna is lowercase
letter. So I suppose that I can deal with it by this. But I don't know how
to do that~
Thanks,
Amy
------------------------------
Date: Fri, 15 Aug 2008 13:26:53 GMT
From: Jürgen Exner <jurgenex@hotmail.com>
Subject: Re: Help: Show specific part
Message-Id: <7i0ba49n8usm7du43kadl6qpt01dl64dv6@4ax.com>
Amy Lee <openlinuxsource@gmail.com> wrote:
>On Fri, 15 Aug 2008 13:02:12 +0000, Jürgen Exner wrote:
>>>Because of lacking of Perl knowledge, could you show me some tips?
>>
>> In how far is the text marked as "output" different from the part marked
>> as "protein"? They appear to be identical to me. But then again I did
>> not compare each and every character in those lengthy sequences.
>
>Well, actually speaking, the protein is upper letter, and dna is lowercase
>letter.
What on earth are you talking about? I was asking about what is the
difference between your "output" and your "protein" character sequences,
i.e. how do you want your Perl script to manipulate/change/modify those
character sequences?
>So I suppose that I can deal with it by this. But I don't know how
>to do that~
I have no idea what you are talking about. What "that" are you referring
to?
jue
------------------------------
Date: Fri, 15 Aug 2008 21:39:02 +0800
From: Amy Lee <openlinuxsource@gmail.com>
Subject: Re: Help: Show specific part
Message-Id: <pan.2008.08.15.13.39.01.148819@gmail.com>
On Fri, 15 Aug 2008 13:26:53 +0000, Jürgen Exner wrote:
> Amy Lee <openlinuxsource@gmail.com> wrote:
>>On Fri, 15 Aug 2008 13:02:12 +0000, Jürgen Exner wrote:
>>>>Because of lacking of Perl knowledge, could you show me some tips?
>>>
>>> In how far is the text marked as "output" different from the part marked
>>> as "protein"? They appear to be identical to me. But then again I did
>>> not compare each and every character in those lengthy sequences.
>>
>>Well, actually speaking, the protein is upper letter, and dna is lowercase
>>letter.
>
> What on earth are you talking about? I was asking about what is the
> difference between your "output" and your "protein" character sequences,
> i.e. how do you want your Perl script to manipulate/change/modify those
> character sequences?
>
>>So I suppose that I can deal with it by this. But I don't know how
>>to do that~
>
> I have no idea what you are talking about. What "that" are you referring
> to?
>
> jue
Hmm, sorry to my poor English. Anyway, I will describe my problem in
details.
In fact, perl dose not modify any characters. As you know before, The
"output" is separated by two parts, upper letter part(dna sequences) and
lowercase letter part(protein sequences). And what I want to do is save
the "protein" part into a file and save the "dna" part into another file.
I need not change any characters.
Furthermore, there's a tag like ">xxx" and the tag follows sequences. I
hope I keep this tag when I save the "dna" part and "protein" part.
Thank you very much~
Regards,
Amy
------------------------------
Date: Fri, 15 Aug 2008 14:17:12 GMT
From: Jürgen Exner <jurgenex@hotmail.com>
Subject: Re: Help: Show specific part
Message-Id: <ep1ba4lejh393vl9b68m0m9v14145gq4gl@4ax.com>
Amy Lee <openlinuxsource@gmail.com> wrote:
>In fact, perl dose not modify any characters. As you know before, The
>"output" is separated by two parts, upper letter part(dna sequences) and
>lowercase letter part(protein sequences).
No, I did not know. It may have been obvious to you but I did not notice
that detail in the long complicated character sequences. Thank you for
the explanation.
>And what I want to do is save
>the "protein" part into a file and save the "dna" part into another file.
Ok, those four lines of explanation make it quite clear what you want to
do. Posting only samples doesn't help because it leaves too much room
for confusion and misunderstandings.
>Furthermore, there's a tag like ">xxx" and the tag follows sequences. I
>hope I keep this tag when I save the "dna" part and "protein" part.
Here's how I would do it (sketch of code only, details and error
handling omitted):
open() the input file, open() two output files 'dna' and 'protein' with
properly named file handles $DNA and $PROTEIN.
Then
while (<$IN>) {#loop through input file
if (substr ($_, 0, 1) eq '>' ){ #found tag in this line
my $next = <$IN>; #get next line for analysis
$isDNA = $next eq lc($next); #set flag for DNA or Prot
print ($isDNA ? $DNA : $PROTEIN) $_, $next;
#print tag line and line from analysis to
#either $DNA or $PROTEIN depending on flag
} else { #not a tag line but regular data
print ($isDNA ? $DNA : $PROTEIN) $_; #print normal data line
}
jue
------------------------------
Date: Fri, 15 Aug 2008 11:34:11 -0400
From: Sherm Pendley <spamtrap@dot-app.org>
Subject: Re: How do I produce a useful error message when a file upload is too big?
Message-Id: <m1od3ufg24.fsf@dot-app.org>
slugger3113 <sstark@hi-beam.net> writes:
> I have a CGI script that allows users to upload image files to a
> website. I limit the file size to 75K.
>
> The problem is if someone tries to upload a file larger than 75K, and
> the user clicks Submit, the script basically just resets itself with
> no warning; none of the functions get triggered.
>
> Can someone tell me how to capture that "event" when a file size is
> larger than 75K, and allow me to display a proper error message ("File
> too big...")?
>
> Here's what I've got, which successfully uploads the file if it's 75K
> or lower, but doesn't display an error message if it's bigger:
>
> my($imageFileMaxSize) = 75000;
> $CGI::POST_MAX = $imageFileMaxSize;
>
> # other stuff defining image name, path, etc.
>
> sub create_new_image_file {
> my $newImageFile = @_;
>
> $file = param('imagefile');
According to the CGI.pm docs, param() returns an empty list if the
post is too large, and cgi_error() returns "413 POST too large".
if (!$file && cgi_error()) {
# Handle the error
}
> open (SAVE, ">$newImageFilenamePath") || on_error("Can't save $file
> to $newImageFilenamePath");
> while (read($file,$data,1024)) {
> print SAVE $data;
> $imageFileLength += length($data);
> on_error("Image file is too large; maximum size allowed is
> $imageFileMaxSize")
> if($imageFileLength > $imageFileMaxSize);
This only triggers if more than POST_MAX bytes have been read. But, if
the uploaded file is too large, then *nothing* will be read, so this
check never gets triggered.
sherm--
--
My blog: http://shermspace.blogspot.com
Cocoa programming in Perl: http://camelbones.sourceforge.net
------------------------------
Date: Fri, 15 Aug 2008 17:51:03 -0500
From: Tad J McClellan <tadmc@seesig.invalid>
Subject: Re: How do I produce a useful error message when a file upload is too big?
Message-Id: <slrngac22n.ecd.tadmc@tadmc30.sbcglobal.net>
slugger3113 <sstark@hi-beam.net> wrote:
> Here's what I've got, which successfully uploads the file
If you say so.
> sub create_new_image_file {
> my $newImageFile = @_;
You never use this variable, so what is it there for?
If you did mean to use it, you realize that it contains a number, don't you?
--
Tad McClellan
email: perl -le "print scalar reverse qq/moc.noitatibaher\100cmdat/"
------------------------------
Date: Fri, 15 Aug 2008 08:03:34 -0700 (PDT)
From: slugger3113 <sstark@hi-beam.net>
Subject: How do I produce a useful error message when a file upload is too big?
Message-Id: <4366afa3-eddf-4fda-9e46-cd545d7b0e7d@25g2000hsx.googlegroups.com>
I have a CGI script that allows users to upload image files to a
website. I limit the file size to 75K.
The problem is if someone tries to upload a file larger than 75K, and
the user clicks Submit, the script basically just resets itself with
no warning; none of the functions get triggered.
Can someone tell me how to capture that "event" when a file size is
larger than 75K, and allow me to display a proper error message ("File
too big...")?
Here's what I've got, which successfully uploads the file if it's 75K
or lower, but doesn't display an error message if it's bigger:
my($imageFileMaxSize) = 75000;
$CGI::POST_MAX = $imageFileMaxSize;
# other stuff defining image name, path, etc.
sub create_new_image_file {
my $newImageFile = @_;
$file = param('imagefile');
open (SAVE, ">$newImageFilenamePath") || on_error("Can't save $file
to $newImageFilenamePath");
while (read($file,$data,1024)) {
print SAVE $data;
$imageFileLength += length($data);
on_error("Image file is too large; maximum size allowed is
$imageFileMaxSize")
if($imageFileLength > $imageFileMaxSize);
}
close(SAVE);
on_error("File was not received; check filename.")
if($imageFileLength < 1);
}
thanks for any advice!
Scott
------------------------------
Date: Fri, 15 Aug 2008 12:14:53 -0700 (PDT)
From: slugger3113 <sstark@hi-beam.net>
Subject: Re: How do I produce a useful error message when a file upload is too big?
Message-Id: <5ab5fc9f-5afd-44bc-a79a-1aedf5db8c11@l64g2000hse.googlegroups.com>
That was it, thank you!
Scott
On Aug 15, 10:34=A0am, Sherm Pendley <spamt...@dot-app.org> wrote:
> slugger3113 <sst...@hi-beam.net> writes:
> > I have a CGI script that allows users to upload image files to a
> > website. I limit the file size to 75K.
>
> > The problem is if someone tries to upload a file larger than 75K, and
> > the user clicks Submit, the script basically just resets itself with
> > no warning; none of the functions get triggered.
>
> > Can someone tell me how to capture that "event" when a file size is
> > larger than 75K, and allow me to display a proper error message ("File
> > too big...")?
>
> > Here's what I've got, which successfully uploads the file if it's 75K
> > or lower, but doesn't display an error message if it's bigger:
>
> > my($imageFileMaxSize) =3D 75000;
> > $CGI::POST_MAX =3D $imageFileMaxSize;
>
> > # other stuff defining image name, path, etc.
>
> > sub create_new_image_file {
> > =A0my $newImageFile =3D @_;
>
> > =A0$file =3D param('imagefile');
>
> According to the CGI.pm docs, param() returns an empty list if the
> post is too large, and cgi_error() returns "413 POST too large".
>
> =A0 =A0 if (!$file && cgi_error()) {
> =A0 =A0 =A0 =A0 # Handle the error
> =A0 =A0 }
>
> > =A0open (SAVE, ">$newImageFilenamePath") || on_error("Can't save $file
> > to $newImageFilenamePath");
> > =A0while (read($file,$data,1024)) {
> > =A0 print SAVE $data;
> > =A0 $imageFileLength +=3D length($data);
> > =A0 on_error("Image file is too large; maximum size allowed is
> > $imageFileMaxSize")
> > =A0 =A0if($imageFileLength > $imageFileMaxSize);
>
> This only triggers if more than POST_MAX bytes have been read. But, if
> the uploaded file is too large, then *nothing* will be read, so this
> check never gets triggered.
>
> sherm--
>
> --
> My blog:http://shermspace.blogspot.com
> Cocoa programming in Perl:http://camelbones.sourceforge.net- Hide quoted =
text -
>
> - Show quoted text -
------------------------------
Date: Fri, 15 Aug 2008 09:34:05 -0700 (PDT)
From: Slickuser <slick.users@gmail.com>
Subject: Perl Dev Kit
Message-Id: <f5cc8d83-e10a-4dba-a664-1c04a7b75d92@p31g2000prf.googlegroups.com>
Have any one familiar with Perl Dev Kit?
I want to compile my game.pl script to executable.
So I can run this command "game" anywhere on command windows. Maybe
set some environment variable?
Any help>
Currently, I have to run where game where it is located with such as
in the C drive otherwise I get this error.
C:\>game
'game' is not recognized as an internal or external command, operable
program or batch file.
I can hack it and manually put it in C:\Windows then I can use game
anywhere I want.
Thanks.
------------------------------
Date: Fri, 15 Aug 2008 18:15:07 +0100
From: Ben Morrow <ben@morrow.me.uk>
Subject: Re: Perl Dev Kit
Message-Id: <r5qgn5-kg7.ln1@osiris.mauzo.dyndns.org>
Quoth Slickuser <slick.users@gmail.com>:
> Have any one familiar with Perl Dev Kit?
>
> I want to compile my game.pl script to executable.
> So I can run this command "game" anywhere on command windows. Maybe
> set some environment variable?
>
> Any help>
>
> Currently, I have to run where game where it is located with such as
> in the C drive otherwise I get this error.
You have converted your perl script into a Windows .exe, so you now have
a file c:\game.exe?
> C:\>game
> 'game' is not recognized as an internal or external command, operable
> program or batch file.
Learn how to use your OS. You need to put it in a directory that is
named in the %PATH% environment variable; if you like, you can add a new
directory to %PATH% and put it there.
I believe you can also create a 'game.exe' key somewhere appropriate in
the registry with the full path, but I don't really know.
> I can hack it and manually put it in C:\Windows then I can use game
> anywhere I want.
C:\Windows is typically in %PATH% already.
Ben
--
It will be seen that the Erwhonians are a meek and long-suffering people,
easily led by the nose, and quick to offer up common sense at the shrine of
logic, when a philosopher convinces them that their institutions are not based
on the strictest morality. [Samuel Butler, paraphrased] ben@morrow.me.uk
------------------------------
Date: Fri, 15 Aug 2008 17:50:38 GMT
From: Jürgen Exner <jurgenex@hotmail.com>
Subject: Re: Perl Dev Kit
Message-Id: <regba4l357fmbuqlu8k02qdsfe4nfuqgkp@4ax.com>
Slickuser <slick.users@gmail.com> wrote:
>Currently, I have to run where game where it is located with such as
>in the C drive otherwise I get this error.
>C:\>game
>'game' is not recognized as an internal or external command, operable
>program or batch file.
Then why don't you add the location of your script to the search path?
>I can hack it and manually put it in C:\Windows then I can use game
>anywhere I want.
What a concept!
May I suggest to learn how to use the operating system you are using?
jue
PS: nothing of this has anything to do with Perl but would happen with
any other program just the same way.
------------------------------
Date: 15 Aug 2008 17:55:14 GMT
From: John Bokma <john@castleamber.com>
Subject: Re: Perl Dev Kit
Message-Id: <Xns9AFB836F4E528castleamber@130.133.1.4>
Slickuser <slick.users@gmail.com> wrote:
> I can hack it and manually put it in C:\Windows then I can use game
> anywhere I want.
A slick user should IMNSHO know that working as Administrator is not a
smart thing to do.
You can set your PATH variable to the directory where game.exe is stored.
--
John http://johnbokma.com/ - Hacking & Hiking in Mexico
Perl help in exchange for a gift:
http://johnbokma.com/perl/help-in-exchange-for-a-gift.html
------------------------------
Date: 15 Aug 2008 16:50:02 GMT
From: xhoster@gmail.com
Subject: Re: perlish way for ( 0 .. $n) , but downcounting
Message-Id: <20080815125004.610$UZ@newsreader.com>
Eric Pozharski <whynot@pozharski.name> wrote:
> hofer <blabla@dungeon.de> wrote:
> *SKIP*
> > for the reverse I'd hesitate to use reverse() as it creates probably
> > the entire list first
>
> Don't guess, benchmark first!
But benchmark something that makes sense. None of the benchmarks
you posted make any sense in this context.
You need to use an example large enough to actually make a noticable dent
in memory, and you need to use the construct in question, which was
the range operators used directly in a foreach, with or without a reverse,
not a array being created first and then used in a foreach.
perl -le 'foreach (1..1e6) {}; print +(`ps -p $$ -o rss `)[1];'
1340
perl -le 'foreach (reverse 1..1e6) {}; print +(`ps -p $$ -o rss `)[1];'
72072
Yes, the reverse does build the whole list first.
Xho
--
-------------------- http://NewsReader.Com/ --------------------
The costs of publication of this article were defrayed in part by the
payment of page charges. This article must therefore be hereby marked
advertisement in accordance with 18 U.S.C. Section 1734 solely to indicate
this fact.
------------------------------
Date: Fri, 15 Aug 2008 05:58:39 -0500
From: Tad J McClellan <tadmc@seesig.invalid>
Subject: Re: This is very OT, and its just a request. It has to do with Ashton Tate Framework 2/PC World contest in the 1980's
Message-Id: <slrngaaoav.7ic.tadmc@tadmc30.sbcglobal.net>
sln@netherlands.com <sln@netherlands.com> wrote:
> Sorry to post this here, but I only posted this here
> so ignore if you don't know. This if very OT for a Perl
> group.
You will get more help if you posted to a newsgroup where
it _was_ on topic...
> I am the inventor of Action Memo and Action Item construct's !!!!
>
> If you think I am telling the truth, and I am, any lawyers out there
> willing to take up my case?
>
> I have not been to a lawyer. I have all the documents from Ashton Tate
> for validation, as well as all the source that can be dated.
Intellectual property lawyers hang out in:
misc.int-property
--
Tad McClellan
email: perl -le "print scalar reverse qq/moc.noitatibaher\100cmdat/"
------------------------------
Date: 6 Apr 2001 21:33:47 GMT (Last modified)
From: Perl-Users-Request@ruby.oce.orst.edu (Perl-Users-Digest Admin)
Subject: Digest Administrivia (Last modified: 6 Apr 01)
Message-Id: <null>
Administrivia:
#The Perl-Users Digest is a retransmission of the USENET newsgroup
#comp.lang.perl.misc. For subscription or unsubscription requests, send
#the single line:
#
# subscribe perl-users
#or:
# unsubscribe perl-users
#
#to almanac@ruby.oce.orst.edu.
NOTE: due to the current flood of worm email banging on ruby, the smtp
server on ruby has been shut off until further notice.
To submit articles to comp.lang.perl.announce, send your article to
clpa@perl.com.
#To request back copies (available for a week or so), send your request
#to almanac@ruby.oce.orst.edu with the command "send perl-users x.y",
#where x is the volume number and y is the issue number.
#For other requests pertaining to the digest, send mail to
#perl-users-request@ruby.oce.orst.edu. Do not waste your time or mine
#sending perl questions to the -request address, I don't have time to
#answer them even if I did know the answer.
------------------------------
End of Perl-Users Digest V11 Issue 1796
***************************************
