[30852] in Perl-Users-Digest
Perl-Users Digest, Issue: 2097 Volume: 11
daemon@ATHENA.MIT.EDU (Perl-Users Digest)
Sun Jan 4 09:10:00 2009
Date: Sun, 4 Jan 2009 06:09:20 -0800 (PST)
From: Perl-Users Digest <Perl-Users-Request@ruby.OCE.ORST.EDU>
To: Perl-Users@ruby.OCE.ORST.EDU (Perl-Users Digest)
Perl-Users Digest Sun, 4 Jan 2009 Volume: 11 Number: 2097
Today's topics:
Re: FAQ 1.8 Is Perl difficult to learn? <ryan.mccoskrie@gmail.com>
Re: Help: Output specific text from a starter <wahab-mail@gmx.de>
Re: Help: Output specific text from a starter <tadmc@seesig.invalid>
Installing a module written in C on a UNIX without root hamidrezah@yahoo.com
Re: Installing a module written in C on a UNIX without <vilain@NOspamcop.net>
Re: Installing a module written in C on a UNIX without xhoster@gmail.com
Re: Installing a module written in C on a UNIX without hamidrezah@yahoo.com
Re: Installing a module written in C on a UNIX without hamidrezah@yahoo.com
new CPAN modules on Sun Jan 4 2009 (Randal Schwartz)
Re: Unit test that checks for "croak" <Peter@PSDT.com>
Digest Administrivia (Last modified: 6 Apr 01) (Perl-Users-Digest Admin)
----------------------------------------------------------------------
Date: Sun, 04 Jan 2009 21:37:37 +1300
From: Ryan McCoskrie <ryan.mccoskrie@gmail.com>
Subject: Re: FAQ 1.8 Is Perl difficult to learn?
Message-Id: <gjpsfh$gqh$1@news.albasani.net>
PerlFAQ Server wrote:
> 1.8: Is Perl difficult to learn?
> [...]
> Things that make Perl easier to learn: Unix experience, almost any
> kind of programming experience, an understanding of regular
> expressions, and the ability to understand other people's code.
One thing that should be added is that perl is a _very_ left-brain
language*. I can tell you that because I don't really have right brain** function. Perl makes sense to me because my own thoughts (all
literal and precise language) are very similar.
That said I respect extreme right-brain languages like scheme
but I can literally feel the stack overflow when I try thinking like
that.
Most perl haters are probably leaning towards the right.
*Left brain is mostly language and logic (the /super class/ to grammar).
**Right brain vision, maths (think of how many maths problems beyond
simple algebra involve visual data) and emotions.
------------------------------------------------------------------------
Quote of the login:
A complex system that works is invariably found to have evolved from a
simple system that works.
------------------------------
Date: Sat, 03 Jan 2009 22:59:35 +0100
From: Mirco Wahab <wahab-mail@gmx.de>
Subject: Re: Help: Output specific text from a starter
Message-Id: <gjoq1g$5ju$1@mlucom4.urz.uni-halle.de>
Amy Lee wrote:
> I have lots of data by following words,
>> gi|GENSCAN_predicted_peptide_1|105_aa
> MASKKTSVLALFIVFNIFFCPMIEETLHVGGHKKEEHKGEPHGEHKGEHKGEQPHGEHKE
> GLVDKIKDKIHGDGHDKGEKKKKKAKKKKEHGHDHHGHSSSSDSD
> ......
>
> So what I hope is to grasp the title with "GENSCAN_predicted_peptide" and
> "GENSCAN_predicted_CDS" separately. What I think is like this, I can make
> two scripts. The first is for "GENSCAN_predicted_peptide" the other is for
> "GENSCAN_predicted_CDS". The first script read every line by while (<>)
> then if find GENSCAN_predicted_peptide will output its following line
> until find a blank line or a line with title GENSCAN_predicted_CDS.
> However, I don't know how to continue. Because I don't know which function
> or method I should use.
Although Tad did already post another solution, I'd like to add that
there is no guarantee for paragraph blocks in regular fasta files
(as your example suggested). Therefore I'd use the '>' as the record
separator, like:
open my $predicted_CDS, '>', 'predicted_CDS' or die $!;
open my $predicted_peptide, '>', 'predicted_peptide' or die $!;
local $/ = '>';
while(<>) {
chomp;
if( /predicted_CDS/ ) { print $predicted_CDS '>'.$_ }
if( /predicted_peptide/ ) { print $predicted_peptide '>'.$_ }
}
Regards
M.
------------------------------
Date: Sun, 4 Jan 2009 07:10:40 -0600
From: Tad J McClellan <tadmc@seesig.invalid>
Subject: Re: Help: Output specific text from a starter
Message-Id: <slrngm1dag.fm9.tadmc@tadmc30.sbcglobal.net>
Amy Lee <openlinuxsource@gmail.com> wrote:
> On Sat, 03 Jan 2009 15:56:46 -0600, Tad J McClellan wrote:
>> if ( /^\Q>gi|GENSCAN_predicted_peptide_1/ )
[ snip 50 lines that are not relevant to the followup ]
> Thank you very much.
You are welcome.
You can show your appreciation by adopting the conventions for
followup style that everybody else uses here.
Have you seen the Posting Guidelines that are posted here frequently?
When composing a followup, quote only enough text to establish the
context for the comments that you will add. Always indicate who
wrote the quoted material. Never quote an entire article. Never
quote a .signature (unless that is what you are commenting on).
Intersperse your comments I<following> each section of quoted text
to which they relate.
You quoted 50 lines but only commented on 1 line.
If you plan to comment on one line, then you should only quote one line.
> And could you tell me what's \Q at this codes?
I could, but I won't.
If I did, then you'll be back again asking about \L or \D or ...
Instead, I will help you learn how to get the answer to your question
without being at the mercy of others.
You have a question about something in a regular expression, so you
should go look it up on the documentation for regular expressions:
perldoc perlre
The answer to your question is on about the 3rd page there.
--
Tad McClellan
email: perl -le "print scalar reverse qq/moc.noitatibaher\100cmdat/"
------------------------------
Date: Sat, 3 Jan 2009 06:57:39 -0800 (PST)
From: hamidrezah@yahoo.com
Subject: Installing a module written in C on a UNIX without root access
Message-Id: <d90c7762-ff50-4a10-8b2a-a57054405784@c36g2000prc.googlegroups.com>
Dear Perl experts:
I am trying to install Algorithm::Combinatorics locally on a UNIX
system without root access. The module or at least portions of it are
written in C. I have the following cc available:
Configured with: ../configure --prefix=/usr --mandir=/usr/share/man --
infodir=/usr/share/info --enable-shared --enable-threads=posix --
disable-checking --with-system-zlib --enable-__cxa_atexit --disable-
libunwind-exceptions --enable-java-awt=gtk --host=x86_64-redhat-linux
Thread model: posix
gcc version 3.4.6 20060404 (Red Hat 3.4.6-9)
So "perl Makefile.PL PREFIX=/home/mydir" works. "make" works well too.
But during "make test" I get the following errors:
PERL_DL_NONLAZY=1 .../perl/5.8.8/bin/perl "-MExtUtils::Command::MM" "-
e" "test_harness(0, 'blib/lib', 'blib/arch')" t/*.t
t/00_load............................
# Failed test 'use Algorithm::Combinatorics;'
t/00_load............................NOK 1# in t/00_load.t at line
6.
# Tried to use 'Algorithm::Combinatorics'.
# Error: Can't load '.../Algorithm-Combinatorics-0.25/blib/arch/
auto/Algorithm/Combinatorics/Combinatorics.so' for module
Algorithm::Combinatorics: .../Algorithm-Combinatorics 0.25/blib/arch/
auto/Algorithm/Combinatorics/Combinatorics.so: cannot open shared
object file: No such file or directory at .../perl/5.8.8/lib/5.8.8/
i686-linux-thread-multi/DynaLoader.pm line 230.
# at (eval 3) line 2
# Compilation failed in require at (eval 3) line 2.
# BEGIN failed--compilation aborted at t/00_load.t line 6.
# Looks like you failed 1 test of 1.
Then I chose the static linking "perl Makefile.PL PREFIX=/home/mydir
LINKTYPE=static". It worked well and "make" finished normally. Then
again "make test" fails giving the following errors:
perlmain.c: In function `xs_init':
perlmain.c:122: warning: passing arg 4 of `Perl_newXS' discards
qualifiers from pointer target type
perlmain.c:127: warning: passing arg 4 of `Perl_newXS' discards
qualifiers from pointer target type
/usr/bin/ld: warning: i386 architecture of input file `.../perl/5.8.8/
lib/5.8.8/i686-linux-thread-multi/CORE/libperl.a(perl.o)' is
incompatible with i386:x86-64 output
/usr/bin/ld: warning: i386 architecture of input file `.../perl/5.8.8/
lib/5.8.8/i686-linux-thread-multi/CORE/libperl.a(gv.o)' is
incompatible with i386:x86-64 output
.../perl/5.8.8/lib/5.8.8/i686-linux-thread-multi/CORE/libperl.a
(perlio.o)(.text+0x4a6c): In function `PerlIOMmap_map':
: undefined reference to `__divdi3'
collect2: ld returned 1 exit status
make[1]: *** [perl] Error 1
Can anyone please help what could be possibly wrong??
Thanks in advance.
Hrh.
------------------------------
Date: Sat, 03 Jan 2009 16:17:19 -0800
From: Michael Vilain <vilain@NOspamcop.net>
Subject: Re: Installing a module written in C on a UNIX without root access
Message-Id: <vilain-8D222D.16171903012009@feeder.motzarella.org>
In article
<d90c7762-ff50-4a10-8b2a-a57054405784@c36g2000prc.googlegroups.com>,
hamidrezah@yahoo.com wrote:
> Dear Perl experts:
>
> I am trying to install Algorithm::Combinatorics locally on a UNIX
> system without root access. The module or at least portions of it are
> written in C. I have the following cc available:
>
> Configured with: ../configure --prefix=/usr --mandir=/usr/share/man --
> infodir=/usr/share/info --enable-shared --enable-threads=posix --
> disable-checking --with-system-zlib --enable-__cxa_atexit --disable-
> libunwind-exceptions --enable-java-awt=gtk --host=x86_64-redhat-linux
> Thread model: posix
> gcc version 3.4.6 20060404 (Red Hat 3.4.6-9)
>
> So "perl Makefile.PL PREFIX=/home/mydir" works. "make" works well too.
> But during "make test" I get the following errors:
>
> PERL_DL_NONLAZY=1 .../perl/5.8.8/bin/perl "-MExtUtils::Command::MM" "-
> e" "test_harness(0, 'blib/lib', 'blib/arch')" t/*.t
> t/00_load............................
> # Failed test 'use Algorithm::Combinatorics;'
> t/00_load............................NOK 1# in t/00_load.t at line
> 6.
> # Tried to use 'Algorithm::Combinatorics'.
> # Error: Can't load '.../Algorithm-Combinatorics-0.25/blib/arch/
> auto/Algorithm/Combinatorics/Combinatorics.so' for module
> Algorithm::Combinatorics: .../Algorithm-Combinatorics 0.25/blib/arch/
> auto/Algorithm/Combinatorics/Combinatorics.so: cannot open shared
> object file: No such file or directory at .../perl/5.8.8/lib/5.8.8/
> i686-linux-thread-multi/DynaLoader.pm line 230.
> # at (eval 3) line 2
> # Compilation failed in require at (eval 3) line 2.
> # BEGIN failed--compilation aborted at t/00_load.t line 6.
> # Looks like you failed 1 test of 1.
>
> Then I chose the static linking "perl Makefile.PL PREFIX=/home/mydir
> LINKTYPE=static". It worked well and "make" finished normally. Then
> again "make test" fails giving the following errors:
>
> perlmain.c: In function `xs_init':
> perlmain.c:122: warning: passing arg 4 of `Perl_newXS' discards
> qualifiers from pointer target type
> perlmain.c:127: warning: passing arg 4 of `Perl_newXS' discards
> qualifiers from pointer target type
>
> /usr/bin/ld: warning: i386 architecture of input file `.../perl/5.8.8/
> lib/5.8.8/i686-linux-thread-multi/CORE/libperl.a(perl.o)' is
> incompatible with i386:x86-64 output
> /usr/bin/ld: warning: i386 architecture of input file `.../perl/5.8.8/
> lib/5.8.8/i686-linux-thread-multi/CORE/libperl.a(gv.o)' is
> incompatible with i386:x86-64 output
>
> .../perl/5.8.8/lib/5.8.8/i686-linux-thread-multi/CORE/libperl.a
> (perlio.o)(.text+0x4a6c): In function `PerlIOMmap_map':
> : undefined reference to `__divdi3'
> collect2: ld returned 1 exit status
> make[1]: *** [perl] Error 1
>
>
> Can anyone please help what could be possibly wrong??
>
> Thanks in advance.
>
> Hrh.
Without root access, you can't install this module into the existing
perl running on the system. At best, you could put the files it uses
into a private perl library that you'd have to "use" at the top of your
code. You should be able to build the module without problems but
apparently the test suite for this module doesn't work on RH when run
without root. You may want to contact the developer about that.
--
DeeDee, don't press that button! DeeDee! NO! Dee...
[I filter all Goggle Groups posts, so any reply may be automatically by ignored]
------------------------------
Date: 04 Jan 2009 00:34:24 GMT
From: xhoster@gmail.com
Subject: Re: Installing a module written in C on a UNIX without root access
Message-Id: <20090103193408.825$eq@newsreader.com>
hamidrezah@yahoo.com wrote:
> Dear Perl experts:
>
> I am trying to install Algorithm::Combinatorics locally on a UNIX
> system without root access. The module or at least portions of it are
> written in C. I have the following cc available:
>
...
>
> PERL_DL_NONLAZY=1 .../perl/5.8.8/bin/perl "-MExtUtils::Command::MM" "-
> e" "test_harness(0, 'blib/lib', 'blib/arch')" t/*.t
The three dots in the .../perl/5.8.8/bin/perl looks suspicious to me.
Is that directly from the output, or did you elide something?
> t/00_load............................
> # Failed test 'use Algorithm::Combinatorics;'
> t/00_load............................NOK 1# in t/00_load.t at line
> 6.
> # Tried to use 'Algorithm::Combinatorics'.
> # Error: Can't load '.../Algorithm-Combinatorics-0.25/blib/arch/
> auto/Algorithm/Combinatorics/Combinatorics.so' for module
Again, three dots in the path to the .so file. Do you know where those
are coming from?
Xho
--
-------------------- http://NewsReader.Com/ --------------------
The costs of publication of this article were defrayed in part by the
payment of page charges. This article must therefore be hereby marked
advertisement in accordance with 18 U.S.C. Section 1734 solely to indicate
this fact.
------------------------------
Date: Sun, 4 Jan 2009 05:23:48 -0800 (PST)
From: hamidrezah@yahoo.com
Subject: Re: Installing a module written in C on a UNIX without root access
Message-Id: <329cd294-f93e-44b6-9b19-7b0c31590886@w39g2000prb.googlegroups.com>
On Jan 3, 7:17=A0pm, Michael Vilain <vil...@NOspamcop.net> wrote:
> In article
> <d90c7762-ff50-4a10-8b2a-a57054405...@c36g2000prc.googlegroups.com>,
>
>
>
>
>
> =A0hamidre...@yahoo.com wrote:
> > Dear Perl experts:
>
> > I am trying to install Algorithm::Combinatorics locally on a UNIX
> > system without root access. The module or at least portions of it are
> > written in C. I have the following cc available:
>
> > Configured with: ../configure --prefix=3D/usr --mandir=3D/usr/share/man=
--
> > infodir=3D/usr/share/info --enable-shared --enable-threads=3Dposix --
> > disable-checking --with-system-zlib --enable-__cxa_atexit --disable-
> > libunwind-exceptions --enable-java-awt=3Dgtk --host=3Dx86_64-redhat-lin=
ux
> > Thread model: posix
> > gcc version 3.4.6 20060404 (Red Hat 3.4.6-9)
>
> > So "perl Makefile.PL PREFIX=3D/home/mydir" works. "make" works well too=
.
> > But during "make test" I get the following errors:
>
> > PERL_DL_NONLAZY=3D1 .../perl/5.8.8/bin/perl "-MExtUtils::Command::MM" "=
-
> > e" "test_harness(0, 'blib/lib', 'blib/arch')" t/*.t
> > t/00_load............................
> > # =A0 Failed test 'use Algorithm::Combinatorics;'
> > t/00_load............................NOK 1# =A0 in t/00_load.t at line
> > 6.
> > # =A0 =A0 Tried to use 'Algorithm::Combinatorics'.
> > # =A0 =A0 Error: =A0Can't load '.../Algorithm-Combinatorics-0.25/blib/a=
rch/
> > auto/Algorithm/Combinatorics/Combinatorics.so' for module
> > Algorithm::Combinatorics: .../Algorithm-Combinatorics 0.25/blib/arch/
> > auto/Algorithm/Combinatorics/Combinatorics.so: cannot open shared
> > object file: No such file or directory at .../perl/5.8.8/lib/5.8.8/
> > i686-linux-thread-multi/DynaLoader.pm line 230.
> > # =A0at (eval 3) line 2
> > # Compilation failed in require at (eval 3) line 2.
> > # BEGIN failed--compilation aborted at t/00_load.t line 6.
> > # Looks like you failed 1 test of 1.
>
> > Then I chose the static linking "perl Makefile.PL PREFIX=3D/home/mydir
> > LINKTYPE=3Dstatic". It worked well and "make" finished normally. Then
> > again "make test" fails giving the following errors:
>
> > perlmain.c: In function `xs_init':
> > perlmain.c:122: warning: passing arg 4 of `Perl_newXS' discards
> > qualifiers from pointer target type
> > perlmain.c:127: warning: passing arg 4 of `Perl_newXS' discards
> > qualifiers from pointer target type
>
> > /usr/bin/ld: warning: i386 architecture of input file `.../perl/5.8.8/
> > lib/5.8.8/i686-linux-thread-multi/CORE/libperl.a(perl.o)' is
> > incompatible with i386:x86-64 output
> > /usr/bin/ld: warning: i386 architecture of input file `.../perl/5.8.8/
> > lib/5.8.8/i686-linux-thread-multi/CORE/libperl.a(gv.o)' is
> > incompatible with i386:x86-64 output
>
> > .../perl/5.8.8/lib/5.8.8/i686-linux-thread-multi/CORE/libperl.a
> > (perlio.o)(.text+0x4a6c): In function `PerlIOMmap_map':
> > : undefined reference to `__divdi3'
> > collect2: ld returned 1 exit status
> > make[1]: *** [perl] Error 1
>
> > Can anyone please help what could be possibly wrong??
>
> > Thanks in advance.
>
> > Hrh.
>
> Without root access, you can't install this module into the existing
> perl running on the system. =A0At best, you could put the files it uses
> into a private perl library that you'd have to "use" at the top of your
> code. =A0You should be able to build the module without problems but
> apparently the test suite for this module doesn't work on RH when run
> without root. =A0You may want to contact the developer about that.
>
> --
> DeeDee, don't press that button! =A0DeeDee! =A0NO! =A0Dee...
> [I filter all Goggle Groups posts, so any reply may be automatically by i=
gnored]- Hide quoted text -
>
> - Show quoted text -
I have tried to "use" the module on top of my code. Just as the "test"
tries to use it. But it cannot load the dynamically loadable module
just made.
I also tried to install it in my local directory as you can read from
my original post. It should be possible to install a module without
root access using PREFIX option passed to the Makefile.PL
Anyways, thanks for your hint.
------------------------------
Date: Sun, 4 Jan 2009 05:24:44 -0800 (PST)
From: hamidrezah@yahoo.com
Subject: Re: Installing a module written in C on a UNIX without root access
Message-Id: <f44deb78-a7d6-4bba-acda-fdf94b54b40f@n33g2000pri.googlegroups.com>
On Jan 3, 7:34=A0pm, xhos...@gmail.com wrote:
> hamidre...@yahoo.com wrote:
> > Dear Perl experts:
>
> > I am trying to install Algorithm::Combinatorics locally on a UNIX
> > system without root access. The module or at least portions of it are
> > written in C. I have the following cc available:
>
> ...
>
> > PERL_DL_NONLAZY=3D1 .../perl/5.8.8/bin/perl "-MExtUtils::Command::MM" "=
-
> > e" "test_harness(0, 'blib/lib', 'blib/arch')" t/*.t
>
> The three dots in the .../perl/5.8.8/bin/perl looks suspicious to me.
> Is that directly from the output, or did you elide something?
>
> > t/00_load............................
> > # =A0 Failed test 'use Algorithm::Combinatorics;'
> > t/00_load............................NOK 1# =A0 in t/00_load.t at line
> > 6.
> > # =A0 =A0 Tried to use 'Algorithm::Combinatorics'.
> > # =A0 =A0 Error: =A0Can't load '.../Algorithm-Combinatorics-0.25/blib/a=
rch/
> > auto/Algorithm/Combinatorics/Combinatorics.so' for module
>
> Again, three dots in the path to the .so file. =A0Do you know where those
> are coming from?
>
> Xho
>
> --
> --------------------http://NewsReader.Com/--------------------
> The costs of publication of this article were defrayed in part by the
> payment of page charges. This article must therefore be hereby marked
> advertisement in accordance with 18 U.S.C. Section 1734 solely to indicat=
e
> this fact.
The dots are added by me, the path were too long.
------------------------------
Date: Sun, 4 Jan 2009 05:42:24 GMT
From: merlyn@stonehenge.com (Randal Schwartz)
Subject: new CPAN modules on Sun Jan 4 2009
Message-Id: <KCxMIo.Fq9@zorch.sf-bay.org>
The following modules have recently been added to or updated in the
Comprehensive Perl Archive Network (CPAN). You can install them using the
instructions in the 'perlmodinstall' page included with your Perl
distribution.
ASNMTAP-3.000019
http://search.cpan.org/~asnmtap/ASNMTAP-3.000019/
----
Apache2-Controller-1.000.010
http://search.cpan.org/~markle/Apache2-Controller-1.000.010/
framework for Apache2 handler apps
----
App-PPI-Dumper-0.10_01
http://search.cpan.org/~bdfoy/App-PPI-Dumper-0.10_01/
Use the PPI to dump the structure of a Perl file
----
CGI-Application-4.21
http://search.cpan.org/~markstos/CGI-Application-4.21/
Framework for building reusable web-applications
----
Data-FormValidator-4.62
http://search.cpan.org/~markstos/Data-FormValidator-4.62/
Validates user input (usually from an HTML form) based on input profile.
----
Data-FormValidator-4.63
http://search.cpan.org/~markstos/Data-FormValidator-4.63/
Validates user input (usually from an HTML form) based on input profile.
----
Date-Korean-0.0.2
http://search.cpan.org/~aero/Date-Korean-0.0.2/
Conversion between Korean solar / lunisolar date.
----
Devel-NYTProf-2.07_90
http://search.cpan.org/~timb/Devel-NYTProf-2.07_90/
Powerful feature-rich perl source code profiler
----
File-Find-Object-0.1.5
http://search.cpan.org/~shlomif/File-Find-Object-0.1.5/
An object oriented File::Find replacement
----
File-PackageIndexer-0.01
http://search.cpan.org/~smueller/File-PackageIndexer-0.01/
Indexing of packages and subs
----
File-Type-WebImages-1.01
http://search.cpan.org/~markstos/File-Type-WebImages-1.01/
determine web image file types using magic
----
Git-FastExport-0.07
http://search.cpan.org/~book/Git-FastExport-0.07/
A module to parse the output of git-fast-export
----
Git-Github-Creator-0.17
http://search.cpan.org/~bdfoy/Git-Github-Creator-0.17/
Create a Github repository from your local repository
----
Gtk2-Ex-Entry-Pango-0.03
http://search.cpan.org/~potyl/Gtk2-Ex-Entry-Pango-0.03/
Gtk2 Entry that accepts Pango markup.
----
Heap-MinMax-0.02
http://search.cpan.org/~mbeebe/Heap-MinMax-0.02/
Perl implementation of a Min-Max Heap
----
Heap-MinMax-0.03
http://search.cpan.org/~mbeebe/Heap-MinMax-0.03/
Perl implementation of a Min-Max Heap
----
IO-Moose-0.0601
http://search.cpan.org/~dexter/IO-Moose-0.0601/
Reimplementation of IO::* with improvements
----
KiokuDB-0.18
http://search.cpan.org/~nuffin/KiokuDB-0.18/
Object Graph storage engine
----
LaTeX-Table-0.9.11
http://search.cpan.org/~limaone/LaTeX-Table-0.9.11/
Perl extension for the automatic generation of LaTeX tables.
----
MiniPAN-0.01
http://search.cpan.org/~lev/MiniPAN-0.01/
A minimalistic installer of CPAN modules for the iPhone
----
MooseX-Attribute-0.01
http://search.cpan.org/~ctbrown/MooseX-Attribute-0.01/
create extendable and reusable attributes
----
Net-DNSBL-Monitor-0.11
http://search.cpan.org/~miker/Net-DNSBL-Monitor-0.11/
Monitor DNSBL response
----
ORLite-1.17
http://search.cpan.org/~adamk/ORLite-1.17/
Extremely light weight SQLite-specific ORM
----
PAR-Dist-0.42
http://search.cpan.org/~smueller/PAR-Dist-0.42/
Create and manipulate PAR distributions
----
Padre-Plugin-Perl6-0.016
http://search.cpan.org/~azawawi/Padre-Plugin-Perl6-0.016/
Padre plugin for Perl6
----
Padre-Plugin-Perl6-0.017
http://search.cpan.org/~azawawi/Padre-Plugin-Perl6-0.017/
Padre plugin for Perl6
----
Padre-Plugin-Perl6-0.018
http://search.cpan.org/~azawawi/Padre-Plugin-Perl6-0.018/
Padre plugin for Perl6
----
Padre-Plugin-Perl6-0.019
http://search.cpan.org/~azawawi/Padre-Plugin-Perl6-0.019/
Padre plugin for Perl6
----
Panotools-Script-0.20
http://search.cpan.org/~bpostle/Panotools-Script-0.20/
Panorama Tools scripting
----
Parse-USDASR-0.01
http://search.cpan.org/~gugod/Parse-USDASR-0.01/
Parse USDA Food nutrition standard reference data files.
----
Path-Router-0.05
http://search.cpan.org/~hdp/Path-Router-0.05/
A tool for routing paths
----
Perl6-Cookbook-0.02
http://search.cpan.org/~szabgab/Perl6-Cookbook-0.02/
Examples in Perl 6
----
Regexp-Common-debian-0.0.11
http://search.cpan.org/~whynot/Regexp-Common-debian-0.0.11/
----
SMS-Send-TW-emome-0.02
http://search.cpan.org/~snowfly/SMS-Send-TW-emome-0.02/
SMS::Send driver for www.emome.net
----
SNMP-Map-1.01
http://search.cpan.org/~kasha/SNMP-Map-1.01/
Tool for drawing network map
----
Syntax-Highlight-Perl6-0.02963
http://search.cpan.org/~azawawi/Syntax-Highlight-Perl6-0.02963/
Perl 6 Syntax Highlighter
----
Test-Continuous-0.60
http://search.cpan.org/~gugod/Test-Continuous-0.60/
Run your tests suite continusouly when developing.
----
Test-NeedsDisplay-1.06
http://search.cpan.org/~adamk/Test-NeedsDisplay-1.06/
Ensure that tests needing a display have one
----
Tree-AVL-0.04
http://search.cpan.org/~mbeebe/Tree-AVL-0.04/
An AVL (balanced binary) tree for time efficient storage and retrieval of comparable objects
----
WWW-PDB-0.00_01
http://search.cpan.org/~miorel/WWW-PDB-0.00_01/
Perl interface to the Protein Data Bank
----
WWW-TinySong-0.00_02
http://search.cpan.org/~miorel/WWW-TinySong-0.00_02/
Get free music links using TinySong
----
WWW-Yahoo-Lyrics-JP-0.02
http://search.cpan.org/~yusukebe/WWW-Yahoo-Lyrics-JP-0.02/
Get lyrics from Yahoo Japan
----
WebService-Simple-0.13
http://search.cpan.org/~yusukebe/WebService-Simple-0.13/
Simple Interface To Web Services APIs
----
Win32-SqlServer-DTS-0.08.1
http://search.cpan.org/~arfreitas/Win32-SqlServer-DTS-0.08.1/
Perl classes to access Microsoft SQL Server 2000 DTS Packages
----
Win32-SqlServer-DTS-0.08.2
http://search.cpan.org/~arfreitas/Win32-SqlServer-DTS-0.08.2/
Perl classes to access Microsoft SQL Server 2000 DTS Packages
----
XML-RSS-1.42
http://search.cpan.org/~shlomif/XML-RSS-1.42/
creates and updates RSS files
----
Xacobeo-0.05_01
http://search.cpan.org/~potyl/Xacobeo-0.05_01/
XPath (XML Path Language) visualizer.
----
maybe-0.0201
http://search.cpan.org/~dexter/maybe-0.0201/
Use a Perl module and ignore error if can't be loaded
----
pake-0.21
http://search.cpan.org/~izi/pake-0.21/
If you're an author of one of these modules, please submit a detailed
announcement to comp.lang.perl.announce, and we'll pass it along.
This message was generated by a Perl program described in my Linux
Magazine column, which can be found on-line (along with more than
200 other freely available past column articles) at
http://www.stonehenge.com/merlyn/LinuxMag/col82.html
print "Just another Perl hacker," # the original
--
Randal L. Schwartz - Stonehenge Consulting Services, Inc. - +1 503 777 0095
<merlyn@stonehenge.com> <URL:http://www.stonehenge.com/merlyn/>
Smalltalk/Perl/Unix consulting, Technical writing, Comedy, etc. etc.
See http://methodsandmessages.vox.com/ for Smalltalk and Seaside discussion
------------------------------
Date: Sun, 04 Jan 2009 12:48:23 GMT
From: Peter Scott <Peter@PSDT.com>
Subject: Re: Unit test that checks for "croak"
Message-Id: <re28l.66085$H11.19450@newsfe09.iad>
On Mon, 29 Dec 2008 11:14:55 -0800, freesoft12@gmail.com wrote:
> I have a module that calls 'croak' if the input argument to my function
> is wrong. I want to write a unit test that tests if 'croak' is called
> when I give a bad input.
use Test::Exception;
dies_ok { } ...
throws_ok { } ...
--
Peter Scott
http://www.perlmedic.com/
http://www.perldebugged.com/
------------------------------
Date: 6 Apr 2001 21:33:47 GMT (Last modified)
From: Perl-Users-Request@ruby.oce.orst.edu (Perl-Users-Digest Admin)
Subject: Digest Administrivia (Last modified: 6 Apr 01)
Message-Id: <null>
Administrivia:
#The Perl-Users Digest is a retransmission of the USENET newsgroup
#comp.lang.perl.misc. For subscription or unsubscription requests, send
#the single line:
#
# subscribe perl-users
#or:
# unsubscribe perl-users
#
#to almanac@ruby.oce.orst.edu.
NOTE: due to the current flood of worm email banging on ruby, the smtp
server on ruby has been shut off until further notice.
To submit articles to comp.lang.perl.announce, send your article to
clpa@perl.com.
#To request back copies (available for a week or so), send your request
#to almanac@ruby.oce.orst.edu with the command "send perl-users x.y",
#where x is the volume number and y is the issue number.
#For other requests pertaining to the digest, send mail to
#perl-users-request@ruby.oce.orst.edu. Do not waste your time or mine
#sending perl questions to the -request address, I don't have time to
#answer them even if I did know the answer.
------------------------------
End of Perl-Users Digest V11 Issue 2097
***************************************
